Blonde Female Tumblr Art

👉🏻👉🏻👉🏻 ALL INFORMATION CLICK HERE 👈🏻👈🏻👈🏻
michelle kingdom, ‘in spite of everything’, 2016
happy valentine’s day <3 smooch smooch
Популярные блоги на тему "female-art"
A place for feminist art history and women artists to be celebrated. Also, to further educate on the important contributions that all women artists made to the art historical canon.
Halo! Nuvex here // Digital artist // No Requests No RP// English and Spanish // Beginner animator // Commissions: CLOSED // Creator of those Undertale comic //IG: @artistnuvex // I will Frans-Service you!~//
Posting original 3D giantess and pin-up art. Topless and nude images at my Patreon. Reblogging art, glamour, design, etc.
i asked my friend if he wanted to go see some cave paintings with me and he said "lascaux" (let's go)
teest/25/♀/korean/drawing fan arts my twitter: @pinkteest
Someone sent me a message that my Adler x Bell fan art was perfectly traced, but I accidentally erased it. I'm sorry, but anyone is fine, can you tell me again?
I just wanna say, I fucking LOVE your art. I love seeing it on my dash and its such a nice art style too!!
Art that I love. Two posts a day, linked by theme, subject matter, color. There's an emphasis on fine art, especially painting, but I also feature graphic design, illustration, sculpture, fashion, and architecture as the mood strikes me.
Ker | 25 | He/him | Anthro/furry commissions & art | Main blog: robot-island | Social media links
My name is Lina. Artist - illustrator from Russia. Welcome to my gallery! ❤ instagram - evaline_art ❤
Freelance artist. Crafter of pretty things. In love with design, illustration, photography and art.
illustrator based in Porto / ig: dieannne / Do not edit or repost / commissions open
Tattoo Artist || @_tatulu || 🏳️🌈🇵🇹🇬🇭🇨🇲🇸🇪
Welcome! This is the art spam blog of Poisonheaven. Two posts a day: Mon - Wed - Fri.
18+ only! 🔞🔞Wg kink art. Lots of drawings of growing girls 💖 Commissions: open ✅ Feel free to dm us! Support us on kofi!: ko-fi.com/peachpeachplumb
Super-Chi is a self-taught artist who specializes in ink, pencil, and marker work. She is also somewhat obsessed with cats.
I don't draw. I just reblog those that can.
I like flowers, forests, space and magic ✨ Slovenia, 25 years, ENFP🌙
Bonnie Lou. 24. Artist. Massachusetts.
Oh geeze people are unearthing my old mass effect art from my first art blog
Idk how they found it, that stuff is from like 2014 2015?
I should probably move some of that art here for archive sake
Programming, Arduino enthusiast. Logician, Self-employed. She/her. I draw alot.
“To be an artist is a guarantee to your fellow humans that the wear and tear of living will not let you become a murderer”
Welcome to my art blog. I'm mostly posting phanart or fanart in general, wtj and personal art.
Quiet, meditative seascapes and nature-inspired abstracts www.mgloriahunterart.com
Cuddly, protective vore is the shit. Everything here, whether it's rebloged or original content, will be nonfatal. Also not sexual in anyway, i'm ace and I like this purely for the fluffy aspect. So please don't send anything sexy into my inbox or anything like that. If you can be chill about that, then we can be buds~ Will also feature some non-vore g/t stuff since I love that too. I'm on AO3 as darling_diary! Feel free to come into my ask any time! I do not do 1 on 1 roleplay Call me Darling.
man i jus wanna b tiny n get finger pets ;-(
hannahagostaillustration.tumblr.com
illustrations, observations, flowers.
Art, Booze, & Heeled Shoes. (Etrujii artwork and thoughts.)
Check out my full portfolio at www.filouvasiliki.art
23 // she/her // bi // This is art. I am art // Instagram: @yyyessie
a pose database for inspiration and reference when drawing, using FFXIV's gpose tool.
🌸I'm Sarah (Puff) She/Her🌸 I make art sometimes🌸Pan🌸Plant eater🌸24🌸
Want to create a religion for your fictional world? Here are some references and resources!
freelance illustrator, would-be writer. must be stopped before it's too late. (but it probably already is).
27. F, Illustrator, Siberia. For commissions DM me on discord Aly#9061
Hellllllo.... this blog... is just... just allllllllllllllllll over the place. Sorry.
sveta kerro, 20 y.o, contemporary artist. inst&twitter: kerrotin
blackfemmecharacterdependency.tumblr.com
TV. Movies. Books. Stage. Podcasts. Here for the Black fangirls and women tired of not seeing themselves represented in media or their characters appreciated in fandom. Submit Content Suggestions in my submit button labeled, "Gimme whatcha got," or send me an ask under the tab, "Hey, Gurl. What's goin' on?" Main: NeshaTriumphs
Byleth | 19 | talented bitch | irish catholic | She/Her | Aspergers Syndrome | Lots of dimileth art here | s/i kins: byleth eisner | rhea dni please
I creat content for my various fandoms, sometimes. mostly I just share whatever I like.
River in canon: capable, strong, loyal, caring, seasoned detective, street smart, witty, intuitive, resourceful, confident, fierce, headstrong, self assured
she/her 22 rus (my english is bad) https://twitter.com/MalWaDudiHa
LORY | follows back as lesbianwaves | instagram.com/lorenzarts | redbubble.com/people/waveswitch
Fanartist & freelance illustrator / 94 / https://linktr.ee/eshraq_alsaied
Sketch for Mo Ran before going to bed
Argentinian artist 🌼🌿 You can repost, just credit
Okay. I’m going to go now and enjoy the wonderful summer outside🥰 Maybe you should reconsider your words in the future - how you approach people on the internet. People don’t just owe you things - or free art for that matter. Being kind goes a long way you know..💕🙏☀️
Recently I’ve been drawing/painting entirely in the Procreate app on a iPad✨ My older stuff is all Photoshop🥰 hope this helps!🌸
Awwww your art is really good!! 💗💗💗 ignore the haters btw
Summer | 18 | She/They | Art Student | Insta: @arugulafriend https://linktr.ee/arugulafriend
Heloisa F. Pajtak. Artist, 110 years old.
Hi I'm Ari! I'm an Artist and Gaming Enthusiast. I like drawing fun, colorful things and am currently into FFXIV and D&D. Twitter | Kofi | Etsy
Artist, scenic painter, cat mom: I create art of things I love in a variety of mediums including gouache, watercolor, and ink.
Twitter: @BorealYoako Deviantart: TheBorealYoako Newgrounds: Yoako Buy me a ko-fi!
Julian Schnabel said, [ “I think when people make art it is of it's time and it defines it's time” ]
This design is part of my collection with @kosuapparel that’s out now! This is my favourite design out of the 3. 😌 Click here or click the link in my bio to shop 🚶♂️ * @kosuapparel is based in the UK. All shipping and sizing info is on their website. They’re also offering 10% off right now due to c0vid delays 😳
Gogi Saroj Pal (Indian, b. 1945), Homecoming, 1990
Everyday I grieve the fact female art has been suppressed for centuries. All those expressions of female pain and female passion silenced all for males to paint the same christian dick worshipping paintings over and over, I will never forgive males for that
The Feminomicon is an artistic guidebook chronicling mythical women from around the world, written and illustrated in the style of the legendary Lovecraftian tome. It was successfully funded on Kickstarter and shipping soon! What better way to show appreciation for my wonderful backers than a gallery of finished art!
Hecate- The goddess of guidance, crossroads, and magical arts, Hecate offers directions through life and darkness to those who beseech her. Regarded as the ruler of three paths, she is believed to hold dominion over all three mortal kingdoms; the earth, the sea, and the sky.
Aswang- For the island inhabitants of the Philippines, nothing is more terrifying than the shape-shifting goul known as the Aswang. Every night the Aswang sheds its human disguise and sprints out into the night in search of easy prey. These predatory women may adopt many forms, but can always be identified by the soft "tik tik" noises produced as they approach their victim.
La Llorona - A Weeping South American ghost Wandering the Earth for eternity, the La Llorona appears as a tall, ethereal, crying Woman dressed in White. She is a specter of motherhood, fury, loss, and revenge. The Wailing of the La Llorona brings misfortune and doom down upon those who hear her.
Deep in the South American jungles, dwells the one legged shape-shifting vampire Pata Sola. She is a dark protector of the forest, confusing and manipulating those Who enter her domain to prevent their return. The Patasola comes to loggers, herdsmen, miners and other men Who Work in and around forests and jungles. She appears when their minds Wanders to sex, and Will often adopt the likeness of a loved one or a beautiful Woman to lure them away from their work.
Through the dark forests of Northern Europe, Ajatar brings pestilence and death to all who cross her terrible path. She is the great serpent, feeder on the sick and the Weak, a powerful spirit known as the "Devil of the Woods".
Futa Kuchi Onna- This terrifying Japanese yokai emerges from the hunger and dissatisfaction of repressed young women. A human girl becomes and Futa kuchi Onna when a slobbering, whining, ever-dissatisfied mouth emerges tumor-like from the back of her skull. This mouth is hidden beneath her hair, out of view from anyone else, but capable of exerting some control over its host though constant sinister whispering and begging.
Itzpapalotl- Known as the Obsidian-Butterfly, Itzpapalotl is a skull-faced warrior goddess of flint knives and sacrifice in the Aztec mythology. She leads the Tzitzimime, an army of female star-demons that dwell in darkness and plot to overwhelm and consume all of humankind.
Black Annis- A Carnivorous crone from the English countryside, Black Annis is emaciated and blue faced with sharp yellow teeth, iron talons, long black hair, and an unquenchable appetite for human flesh. She dwells in a cave in the Dane Hills which she gouged into the stone with her own clawed hands. The cave front is guarded by an ancient oak tree draped in the tattered skins of her victims.
Jorogumo- In the isolated mountain villages of Japan, these massive spider-like creatures Weave powerful illusions to stalk, seduce, and consume helpless human prey. Like many Japanese creatures, Jorogumo begin their lives as ordinary animals and naturally acquire power and intelligence as they grow older. It is thought that When a Japanese orb-Weaver reaches four hundred years of age it swells to the size of a horse and gains the power to shift shape and influence perception.
Keres- Keres are vultures of the spirit realm, embodying violent death on the battlefield, disease, and suffering. Wherever mass death or devastation occurs Keres will swarm and feed.
Baba Yaga- From the dark winter wilds come stories of Baba Yaga, the great bone mother, a ferocious Russian witch in control of powerful magics. Baba Yaga is a knobby kneed hag-like elderly woman with a long nose and wild eyes. Her appearance is hideous, but nothing compared the putrid stench she gives off as she moves. It is said that by merely passing over a household her smell can curdle milk, poison animals, and induce sickness.
Siren- Greek creatures of such potent reputation that their name is synonymous With seduction, Sirens call sailors to their doom from their ever-expanding island of bones.
This diverse compendium would not have been possible without your support! Check it out here.
here’s why men’s art is unconsumable: it’s all abstracts. the pain and suffering and struggle that they go on about, they call the “human experience” but ofc it’s just male experience, mostly white male experience. which is such a privileged experience. they’re just grasping in the dark abt what pain is. women experience the true depths of pain, we plumb the deepest of human suffering. that’s why only female art feels truly authentic for me. who was it that said men fake their own death in their art, while women die over and over again and that death is present in their art. that.
Resting, Amrita Sher-Gil, c. 1939, oil on canvas
A moonlight phantasy by Hilda Hechle (GB, 1886-1939).
Ваш браузер не поддерживается, поэтому что-то может работать не так, как задумано. Используйте последнюю версию Chrome или Firefox
Pulse At Orgasms Teen Girls
Tamil Sex Story Pdf Book In Tamil
Belinda Belly Sucking Dick
Ilk Sex Izle
24 Video Bondage
#female-art on Tumblr
Results for "blonde female" in art | Artfinder
Fab fashion photo art #fashionphotoart | Beautiful girl ...
Blonde Female Tumblr Art






























































